PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo17G0003500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 196aa    MW: 22467 Da    PI: 10.2162
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo17G0003500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.7e-18451148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll ++v q+G g+W++I+++ g++R++k+c++rw++yl
  Spipo17G0003500  4 KGAWTPEEDALLQRCVLQYGEGQWHLIPERAGLRRCRKSCRLRWLNYL 51
                     79********************************************97 PP

2Myb_DNA-binding46.11.1e-1457101147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E +l+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Spipo17G0003500  57 RGAFQEDEVDLIIRLHRLLGNR-WSLIAGRIP-GRTANDIKNYWNSC 101
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.436155IPR017930Myb domain
SuperFamilySSF466891.87E-27298IPR009057Homeodomain-like
SMARTSM007177.6E-15353IPR001005SANT/Myb domain
PfamPF002499.7E-17451IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-22558IPR009057Homeodomain-like
CDDcd001672.97E-11651No hitNo description
PROSITE profilePS5129418.33856106IPR017930Myb domain
SMARTSM007179.6E-1156104IPR001005SANT/Myb domain
PfamPF002499.9E-1457101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2259105IPR009057Homeodomain-like
CDDcd001672.57E-96299No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
KIRKGAWTPE EDALLQRCVL QYGEGQWHLI PERAGLRRCR KSCRLRWLNY LKPSIKRGAF  60
QEDEVDLIIR LHRLLGNRWS LIAGRIPGRT ANDIKNYWNS CLCKKVGAQG KVARKIYKRS  120
TIGMASETYN SCIWGRATLS PRLAHSPEAI LGCRHEIFRP RPRTMSDGPI CLPDTITCRE  180
HFPGGQCCSS TDERPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2541067108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062250.12e-57PREDICTED: transcription factor MYB113-like
SwissprotQ9FNV93e-54MY113_ARATH; Transcription factor MYB113
TrEMBLA0A059BTP41e-57A0A059BTP4_EUCGR; Uncharacterized protein
TrEMBLW8EB733e-57W8EB73_ERYLE; Anthocyanin-activating R2R3 MYB transcription factor
STRINGSolyc10g086250.1.16e-56(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-55myb domain protein 113